DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and Obp8a

DIOPT Version :10

Sequence 1:NP_611448.2 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster


Alignment Length:125 Identity:25/125 - (20%)
Similarity:44/125 - (35%) Gaps:28/125 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALAAFLSMGQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLMEK-QGHLT 72
            :||...:..||.             .::|.|  :......||.....:::.|..|...: |..|.
  Fly    37 SLALLRARDQCG-------------RELTAA--QRLQLDRMQFEDAAHVRHYLHCFWSRLQLWLD 86

  Fly    73 NGQFNAQAMLDTL-----KNVPQIKDKMDEISSGVNACKDIKGTND---CDTAFKVTMCL 124
            ...|.||.::.:.     .||.|....:    :|.||....:|:..   .|..|:..:|:
  Fly    87 ETGFQAQRIVQSFGGERRLNVEQALPAI----NGCNAKTSSRGSGAQTVVDWCFRAFVCV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_611448.2 PhBP 26..128 CDD:214783 21/108 (19%)
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 23/119 (19%)

Return to query results.
Submit another query.