DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and Obp56f

DIOPT Version :9

Sequence 1:NP_001188979.1 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster


Alignment Length:111 Identity:27/111 - (24%)
Similarity:52/111 - (46%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CMETNQVTEADLKE----FMASGMQSSAKEN---LKCYTKCLMEKQGHLTNGQFNAQAMLDTLKN 87
            ||::::..:|.||.    .:....:..|||:   .||:..||:|.:|.:.|...:::.....|:.
  Fly    19 CMKSSEKIKACLKRQLGYTITENTKFDAKEDSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEK 83

  Fly    88 VPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLKEHKAIPGH 133
            ...|.| .||:......|..||.:..|:..:::..|   :::|..|
  Fly    84 KYGITD-TDELEKAEEKCHSIKASGKCELGYEILKC---YQSITKH 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 25/104 (24%)
Obp56fNP_725926.1 PBP_GOBP <52..120 CDD:279703 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.