DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56g and Obp69a

DIOPT Version :9

Sequence 1:NP_995903.1 Gene:Obp56g / 37270 FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:59/134 - (44%) Gaps:10/134 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TFALTLLLGCLSGILA--QQANIDSSVSKE---LVTDCLKENGVTPQDLADLQSGKVKAEDAKDN 63
            :|.|.||:  |..::.  |...|:.::.|:   |...||.:.|.: .|:.| :|.|.:.......
  Fly     7 SFFLALLI--LYDLIPSNQGVEINPTIIKQVRKLRMRCLNQTGAS-VDVID-KSVKNRILPTDPE 67

  Fly    64 VKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFKDVIEKDLDRCSAVKGANACDTAFKILSCF 128
            :||...|:....|.:||...:..:.:.........| .|...:..|...||.:.||||::.:.|:
  Fly    68 IKCFLYCMFDMFGLIDSQNIMHLEALLEVLPEEIHK-TINGLVSSCGTQKGKDGCDTAYETVKCY 131

  Fly   129 QAAN 132
            .|.|
  Fly   132 IAVN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56gNP_995903.1 PBP_GOBP 30..131 CDD:279703 25/103 (24%)
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111689at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.