DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56g and Obp28a

DIOPT Version :9

Sequence 1:NP_995903.1 Gene:Obp56g / 37270 FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster


Alignment Length:138 Identity:37/138 - (26%)
Similarity:64/138 - (46%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRATFALTLLLGCLSGILAQQANIDSSVSK--ELVTDCLKENGVTPQDLADLQSGKVKAEDAKDN 63
            |::|..:.:.:..|...|.:..:...:::|  |....|:.|.|.|..||.::    ||.:.|...
  Fly     1 MQSTPIILVAIVLLGAALVRAFDEKEALAKLMESAESCMPEVGATDADLQEM----VKKQPASTY 61

  Fly    64 V-KCSSQCILVKSGFMDSTGKLLT----DKIKSYYANSNFKDVIEKDL-DRCSAVK-GANACDTA 121
            . ||...|::...|.:|:.|||.|    :|.|.|..|...|..|..:: |.|:|:. ..:.|:.|
  Fly    62 AGKCLRACVMKNIGILDANGKLDTEAGHEKAKQYTGNDPAKLKIALEIGDTCAAITVPDDHCEAA 126

  Fly   122 FKILSCFQ 129
            ....:||:
  Fly   127 EAYGTCFR 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56gNP_995903.1 PBP_GOBP 30..131 CDD:279703 33/109 (30%)
Obp28aNP_523505.1 PhBP 35..134 CDD:214783 30/102 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.