DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or56a and Or67d

DIOPT Version :9

Sequence 1:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:401 Identity:91/401 - (22%)
Similarity:157/401 - (39%) Gaps:96/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLSCALMLARVF----RGYENLNDGATSYATAV-----QYFAVSIAMFNAYVQRDKVISLLRVAH 110
            ||:.|:|.|..|    .||       |.|...|     .....::||..:.||  .:..||..|:
  Fly    40 WLTYAVMAAIAFFFACTGY-------TIYVGVVINGDLTIILQALAMVGSAVQ--GLTKLLVTAN 95

  Fly   111 S-----DIQN----LMHEADNREMELLVATQAYTR-TITLLI---WIPSVIAGLMAYSDCIYRSL 162
            :     ::||    :..|..::..|.....:...| |.||||   .:..::.||:......| .|
  Fly    96 NASHMREVQNTYEDIYREYGSKGDEYAKCLEKRIRITWTLLIGFMLVYIILLGLVITFPIFY-LL 159

  Fly   163 FLPKSV----FNVPAVRRGEEHP------------ILLFQLFPFGELCDNFVVGYLGPWYALGLG 211
            .|.:.|    |.:|.:    :|.            ::|.....||        .|.|..| |.|.
  Fly   160 ILHQKVLVMQFLIPFL----DHTTDGGHLILTAAHVILITFGGFG--------NYGGDMY-LFLF 211

  Fly   212 ITAIPLWHTFITCLMKYVNLKLQILNKRV-EEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVK 275
            :|.:||... |.|      :||...|:.| :..|..::.:.|       .:|..|. ||:...::
  Fly   212 VTHVPLIKD-IFC------VKLTEFNELVMKRNDFPKVRAML-------CDLLVWH-QLYTRMLQ 261

  Fly   276 EQLRIRKFVQELQY-LICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWI 339
            ...:|...|..:|. ..||.::.       .|..:|.......|..:.|..:.:|.|...|    
  Fly   262 TTKKIYSIVLFVQLSTTCVGLLC-------TISCIFMKAWPAAPLYLLYAAITLYTFCGLG---- 315

  Fly   340 YHWHATLIVECHDE-LSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRAL-LVDLNLRTFIDI 402
                 ||:...::: ||:.|.:|.||...:..:|:::.|:..||..:.:.|. :..|::.|.:.:
  Fly   316 -----TLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQL 375

  Fly   403 GRGAYSYFNLL 413
            .:|.||:..:|
  Fly   376 TKGIYSFSMML 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 67/304 (22%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 77/357 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.