DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and TY1

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_177802.2 Gene:TY1 / 844010 AraportID:AT1G76760 Length:172 Species:Arabidopsis thaliana


Alignment Length:100 Identity:29/100 - (28%)
Similarity:61/100 - (61%) Gaps:5/100 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHG 92
            |:..||     .||..::|||:||:||::|:||.||:.:.|.|..|....:.::::.::|.:::.
plant    66 KKQTFD-----SFEDLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYP 125

  Fly    93 ELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYL 127
            .:|..|.:.::|:.::..:|:..:|..|..|::.|
plant   126 SIANKYKIEALPTFILFKDGEPCDRFEGALTAKQL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 25/91 (27%)
TY1NP_177802.2 Thioredoxin_like 69..168 CDD:412351 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.