DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and TH8

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_177146.1 Gene:TH8 / 843324 AraportID:AT1G69880 Length:148 Species:Arabidopsis thaliana


Alignment Length:102 Identity:27/102 - (26%)
Similarity:62/102 - (60%) Gaps:4/102 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IFDVETRKDFEQR---VINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHG 92
            |.:::....::.|   :.::::.:|::|.|.||.|||.|.|:||.:.::... |...::|:|...
plant    39 IVEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTD-VEFVKIDVDVLM 102

  Fly    93 ELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRK 129
            .:.:::|:.::|::|.:..|:.|:.:||::..|..||
plant   103 SVWMEFNLSTLPAIVFMKRGREVDMVVGVKVDELERK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 26/97 (27%)
TH8NP_177146.1 TRX_family 52..141 CDD:239245 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.