DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and THM1

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_849585.1 Gene:THM1 / 839436 AraportID:AT1G03680 Length:179 Species:Arabidopsis thaliana


Alignment Length:133 Identity:36/133 - (27%)
Similarity:68/133 - (51%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSYRRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKA 65
            :||..:..|..||...:......|:|| .|:.:..|   ::..|:.:|.||.|||.|.||.|||.
plant    49 LSSLSKNSRVSRLRRGVICEAQDTATG-IPVVNDST---WDSLVLKADEPVFVDFWAPWCGPCKM 109

  Fly    66 LAPRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKW 130
            :.|.:..:..:..|:.:..:::.||.......|.|.|:|::::..||:..:.::|..:.:.|...
plant   110 IDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLATS 174

  Fly   131 LHK 133
            ::|
plant   175 INK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 27/98 (28%)
THM1NP_849585.1 thioredoxin 79..179 CDD:200072 27/102 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.