DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and ACHT4

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_172333.1 Gene:ACHT4 / 837379 AraportID:AT1G08570 Length:275 Species:Arabidopsis thaliana


Alignment Length:142 Identity:33/142 - (23%)
Similarity:63/142 - (44%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SYRR--LFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINS-DRPVVVDFHASWCCPCK 64
            |:||  ...|:..:.:..|.:......|..:.::.:.::....:.|: |:.|||||.:..|..||
plant    69 SFRRSSAITAQTTLRIGTAQKWWEKGLKDNMREISSAQELVDSLTNAGDKLVVVDFFSPGCGGCK 133

  Fly    65 ALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVI--SNGKVVNRMVGLQTSEYL 127
            ||.|::.. .:|....|:..:|:.:||..:.....|..:|.....  |.|:|.:...   |:..:
plant   134 ALHPKICQ-FAEMNPDVQFLQVNYEEHKSMCYSLGVHVLPFFRFYRGSQGRVCSFSC---TNATI 194

  Fly   128 RKWLHKAVPHPP 139
            :|:......|.|
plant   195 KKFRDALAKHGP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 25/101 (25%)
ACHT4NP_172333.1 TRX_family 115..202 CDD:239245 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43601
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.