DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and TRXF2

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_197144.1 Gene:TRXF2 / 831501 AraportID:AT5G16400 Length:185 Species:Arabidopsis thaliana


Alignment Length:96 Identity:26/96 - (27%)
Similarity:52/96 - (54%) Gaps:4/96 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ETRKDFEQRVINS--DRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGE-LAL 96
            |..||....::.:  |:.||:|.:..||.|||.:||:.:.:..:.:..|.| ::|.::..: ||.
plant    82 EVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFL-KLDCNQDNKPLAK 145

  Fly    97 DYNVGSVPSLVVISNGKVVNRMVGLQTSEYL 127
            :..:..||:..::.:.|||..:.|.:..:.|
plant   146 ELGIRVVPTFKILKDNKVVKEVTGAKYEDLL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 25/95 (26%)
TRXF2NP_197144.1 TRX_family 86..180 CDD:239245 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.