DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and AT5G06430

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_196261.1 Gene:AT5G06430 / 830531 AraportID:AT5G06430 Length:194 Species:Arabidopsis thaliana


Alignment Length:135 Identity:31/135 - (22%)
Similarity:57/135 - (42%) Gaps:21/135 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFRAKRLMNLMKANRGMTSTGKQPIF-------------DVETRKDFEQRVINSDRPVVVDFHAS 58
            |||:.:.:..: |...:||.|:.|.|             :.|.|. |...:.:.....|::|::.
plant    44 LFRSMQTIGSI-ALSSLTSFGQNPNFRPKKKPLSSSEQGEAEQRA-FAAALASQKEATVLEFYSH 106

  Fly    59 WCCPCKALAPRLENVVSEQEGRVRLARVDIDEH---GELALDYNVGSVPSLVVI-SNGKVVNRMV 119
            .|..|.:|...:..|.......:.:...|.:..   .|| |.|:|..||..|:: .||:.:.: .
plant   107 KCRLCNSLLKFVLEVEKRNSNWLSITMADAENEKWFPEL-LHYDVKYVPCFVLLDKNGQALAK-T 169

  Fly   120 GLQTS 124
            |:.:|
plant   170 GVPSS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 21/93 (23%)
AT5G06430NP_196261.1 Thioredoxin_like 91..>167 CDD:412351 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43601
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.