DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and ACHT2

DIOPT Version :10

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_849469.1 Gene:ACHT2 / 829088 AraportID:AT4G29670 Length:236 Species:Arabidopsis thaliana


Alignment Length:115 Identity:29/115 - (25%)
Similarity:55/115 - (47%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSYRRLFRAKRLMNLMKANRGMTSTGKQP----------IFDVETRKDFEQRVINS-DRPVVVD 54
            :.|:..|.|.|..:..:|.:..:..|  :|          :.|:.:.::|...:..: :|.|:|:
plant    67 LGSHLPLRRPKSQVVRVKVDENVAET--EPPKWWERNAPNMVDIHSTEEFLSALSGAGERLVIVE 129

  Fly    55 FHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVP 104
            |:.:||..|:||.|:|.....|....|.| :|:.||:..:....||..:|
plant   130 FYGTWCASCRALFPKLCKTAVEHPDIVFL-KVNFDENKPMCKSLNVRVLP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 CnoX 31..135 CDD:442352 22/75 (29%)
ACHT2NP_849469.1 TRX_family 112..213 CDD:239245 21/68 (31%)

Return to query results.
Submit another query.