DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and ATHM2

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_192261.1 Gene:ATHM2 / 825653 AraportID:AT4G03520 Length:186 Species:Arabidopsis thaliana


Alignment Length:128 Identity:34/128 - (26%)
Similarity:61/128 - (47%) Gaps:4/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENV 73
            |..||...:......|:|..|.:.|    ..::..|:.:..||||||.|.||.|||.:.|.:.::
plant    63 RVSRLRRAVVCEAQETTTDIQVVND----STWDSLVLKATGPVVVDFWAPWCGPCKMIDPLVNDL 123

  Fly    74 VSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVP 136
            .....|:::..:::.||.......|.|.|:|::::...|:..:.::|......|...|.|.:|
plant   124 AQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKDTIIGAVPKTTLTSSLDKFLP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 26/98 (27%)
ATHM2NP_192261.1 thioredoxin 85..185 CDD:200072 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.