DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and TDX

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_188415.2 Gene:TDX / 821056 AraportID:AT3G17880 Length:380 Species:Arabidopsis thaliana


Alignment Length:129 Identity:34/129 - (26%)
Similarity:64/129 - (49%) Gaps:13/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YRRLFRAKRLMNLMKANR---------GMTSTGKQPIFDVETRKDFEQR---VINSDRPVVVDFH 56
            |:||.:.|.|....:..|         ...:.....:..:.:..:.|.:   ...:.|.:::.|.
plant   236 YQRLRKEKELQRAERERRKQQEAQEREAQAALNDGEVISIHSTSELEAKTKAAKKASRLLILYFT 300

  Fly    57 ASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVG 120
            |:||.||:.::|...|:.: |..||...:||||:..::|..:|:.|||:...|.:||.|:::||
plant   301 ATWCGPCRYMSPLYSNLAT-QHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVDKVVG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 28/88 (32%)
TDXNP_188415.2 Hip_N 6..44 CDD:271228
TPR repeat 112..140 CDD:276809
PLN03088 117..>213 CDD:215568
TPR repeat 145..175 CDD:276809
TPR repeat 180..206 CDD:276809
PRK14552 <200..256 CDD:237753 6/19 (32%)
TRX_family 292..374 CDD:239245 27/73 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.