DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and ATHM3

DIOPT Version :10

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001154520.1 Gene:ATHM3 / 816050 AraportID:AT2G15570 Length:174 Species:Arabidopsis thaliana


Alignment Length:91 Identity:23/91 - (25%)
Similarity:52/91 - (57%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNV 100
            |::.:|..|:.|:.||:|:|:.|||.||:.:...::.:..:..|::....::.|....:|.:|.:
plant    73 TQRSWEDSVLKSETPVLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEI 137

  Fly   101 GSVPSLVVISNGKVVNRMVGLQTSEY 126
            .:||.:::..||:....::|....|:
plant   138 KAVPVVLLFKNGEKRESIMGTMPKEF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 CnoX 31..135 CDD:442352 23/91 (25%)
ATHM3NP_001154520.1 CnoX 71..172 CDD:442352 23/91 (25%)

Return to query results.
Submit another query.