DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and Txndc8

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_006538264.1 Gene:Txndc8 / 67402 MGIID:1914652 Length:131 Species:Mus musculus


Alignment Length:104 Identity:28/104 - (26%)
Similarity:46/104 - (44%) Gaps:21/104 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSYRRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKAL 66
            |..:.|...||:.|:.:.....:..|                    ::.|||:|.|.||.|||.:
Mouse    20 SKSQMLIMVKRIKNMSELKELFSDAG--------------------NKLVVVEFSAKWCGPCKTI 64

  Fly    67 APRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPS 105
            ||..: .:|.:...|..|:||:|...|||...::..:|:
Mouse    65 APVFQ-AMSLKYQNVTFAQVDVDSSKELAEHCDITMLPT 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 22/70 (31%)
Txndc8XP_006538264.1 TRX_family 35..128 CDD:239245 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.