DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and txn2

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001008161.1 Gene:txn2 / 493523 XenbaseID:XB-GENE-943373 Length:170 Species:Xenopus tropicalis


Alignment Length:112 Identity:57/112 - (50%)
Similarity:84/112 - (75%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDI 88
            |||..:..|:|:...||::||:.|:.||||||||.||.|||.||||||.||::|:|:|.:|:|||
 Frog    57 TSTPCRVTFNVQDADDFQERVVGSETPVVVDFHAQWCGPCKILAPRLEKVVAKQQGKVVMAKVDI 121

  Fly    89 DEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAV 135
            |:|.:|||::.|.:||:::.|.||.||::.|||:..:.|..:|.|.:
 Frog   122 DDHTDLALEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQLDAFLKKLI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 52/98 (53%)
txn2NP_001008161.1 Thioredoxin_like 69..168 CDD:381987 52/98 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5836
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4511
OMA 1 1.010 - - QHG48905
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm47621
Panther 1 1.100 - - O PTHR43601
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5108
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.