DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and CG3719

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster


Alignment Length:100 Identity:35/100 - (35%)
Similarity:63/100 - (63%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDY 98
            ::...:|:|:|||||.||:|:|||.||.|||.|.|::..:: |....:.||.:|::.:.:|...:
  Fly    53 IKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELL-ENSNEIDLAVIDVETNLDLVETF 116

  Fly    99 NVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHK 133
            .|.:||:::...||.||::.:||..:..:...:.|
  Fly   117 EVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 34/97 (35%)
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9760
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
76.920

Return to query results.
Submit another query.