DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and txn

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001002461.1 Gene:txn / 436734 ZFINID:ZDB-GENE-040718-162 Length:107 Species:Danio rerio


Alignment Length:101 Identity:29/101 - (28%)
Similarity:54/101 - (53%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IFDVETRKDFEQRVINS-DRPVVVDFHASWCCPCKALAPRLENVVSEQEGR-VRLARVDIDEHGE 93
            :.::|.:..|:..:.|: |:.|||||.|:||.||:.:.|..:.:..:.|.: |...:||:|:..:
Zfish     2 VLEIEDKAAFDNALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQD 66

  Fly    94 LALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRK 129
            :|....:..:|:.....|||.|:...|...|:...|
Zfish    67 VAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 28/96 (29%)
txnNP_001002461.1 TRX_family 9..104 CDD:239245 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.