DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and txn2

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_991204.1 Gene:txn2 / 402938 ZFINID:ZDB-GENE-040426-1795 Length:166 Species:Danio rerio


Alignment Length:134 Identity:55/134 - (41%)
Similarity:87/134 - (64%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSYRRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKAL 66
            ||:...|||...:......|....|.:...|:|:...||.:|||||:.||::||||.||.|||.|
Zfish    31 SSFSSCFRAAPPLLSRSIPRLPYITSRSVSFNVQDHDDFTERVINSELPVLIDFHAQWCGPCKIL 95

  Fly    67 APRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWL 131
            .||||..:::|:|||.:|:||||||.:||::|.|.:||:::.:..|.|:::.||::..:.|..::
Zfish    96 GPRLEKAIAKQKGRVTMAKVDIDEHTDLAIEYGVSAVPTVIAMRGGDVIDQFVGIKDEDQLDTFV 160

  Fly   132 HKAV 135
            .|.:
Zfish   161 EKLI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 46/98 (47%)
txn2NP_991204.1 TRX_family 67..161 CDD:239245 45/93 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592661
Domainoid 1 1.000 110 1.000 Domainoid score I6249
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4749
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm26243
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR43601
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5108
SonicParanoid 1 1.000 - - X935
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.