DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and CG14221

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster


Alignment Length:91 Identity:24/91 - (26%)
Similarity:48/91 - (52%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEG-RVRLARVDIDEHGELAL 96
            |:.:.::|| :.:.....:|:|.::.||.||..:...|..:..|..| .::||   |.:.|.::.
  Fly    13 DLASDEEFE-KFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLA---ICKAGSISY 73

  Fly    97 --DYNVGSVPSLVVISNGKVVNRMVG 120
              .:|..|.|:.:.:::||.:|.|.|
  Fly    74 LKRFNKKSEPTWMFVTSGKAINIMFG 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 23/88 (26%)
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 24/91 (26%)
DUF4746 233..508 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.