powered by:
Protein Alignment CG8517 and pdia6
DIOPT Version :9
Sequence 1: | NP_611446.3 |
Gene: | CG8517 / 37268 |
FlyBaseID: | FBgn0034472 |
Length: | 145 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_922915.2 |
Gene: | pdia6 / 322160 |
ZFINID: | ZDB-GENE-030131-879 |
Length: | 440 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 26/75 - (34%) |
Similarity: | 41/75 - (54%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 DFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSV 103
:|.:.||.||...:|:|:|.||..||:|||..:...:..:|.|::..||.|:|..|...|.|...
Zfish 34 NFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKVGAVDADQHNSLGGQYGVRGF 98
Fly 104 PSLVVISNGK 113
|::.:....|
Zfish 99 PTIKIFGGNK 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.