DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and CG18130

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster


Alignment Length:138 Identity:32/138 - (23%)
Similarity:64/138 - (46%) Gaps:41/138 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANRGMTSTGKQPI-FDVETRKDFEQRVINSDRP--VVVDFHASWCCPCKALAPRLENVVSEQEGR 80
            |.:|    |:|.: .|::|.::.|:.:   :||  :|:|.::.||.||:.:.           |.
  Fly     2 AKKG----GQQQLQADIQTDEELERFM---ERPGLLVLDVYSEWCGPCQGMV-----------GS 48

  Fly    81 VRLARVDI-DEHGELAL----------DYNVGSVPSLVVISNGKVVN--------RMVGLQTSEY 126
            :|..::|: .::..||:          .:|..|.|..:.::.|:.||        ::|.|...| 
  Fly    49 LRKIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGSDVPKLVSLLVKE- 112

  Fly   127 LRKWLHKA 134
            |.|.:.|:
  Fly   113 LEKTMQKS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 27/120 (23%)
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 24/114 (21%)
DUF4746 234..556 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.