DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and Txndc9

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_742029.3 Gene:Txndc9 / 280671 RGDID:708355 Length:226 Species:Rattus norvegicus


Alignment Length:135 Identity:32/135 - (23%)
Similarity:63/135 - (46%) Gaps:14/135 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFRAKRLMNLMKA---NRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAP 68
            |.:.|||..|.||   .:...|.|.....::.:.:||.|.|..|:: ||..|:......||.|..
  Rat    46 LLKEKRLAALRKAQQQKQEWLSKGHGEYREIGSERDFFQEVKESEK-VVCHFYRDTTFRCKILDR 109

  Fly    69 RLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQ--------TSE 125
            .|. :::::....:..::::::...|.....:..:|:|.::.:||..:.:||..        |:|
  Rat   110 HLA-ILAKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYIVGFTDLGNTDDFTTE 173

  Fly   126 YLRKW 130
            .| :|
  Rat   174 TL-EW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 23/103 (22%)
Txndc9NP_742029.3 Phd_like_TxnDC9 68..180 CDD:239287 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.