DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and TXN2

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_036605.2 Gene:TXN2 / 25828 HGNCID:17772 Length:166 Species:Homo sapiens


Alignment Length:104 Identity:50/104 - (48%)
Similarity:78/104 - (75%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELAL 96
            |:::...||:.||:||:.||||||||.||.|||.|.||||.:|::|.|:|.:|:||||:|.:||:
Human    62 FNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAI 126

  Fly    97 DYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAV 135
            :|.|.:||:::.:.||.||::.||::..:.|..:|.|.:
Human   127 EYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 49/98 (50%)
TXN2NP_036605.2 TRX_family 72..162 CDD:239245 45/89 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156992
Domainoid 1 1.000 114 1.000 Domainoid score I6084
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4785
Isobase 1 0.950 - 0 Normalized mean entropy S1127
OMA 1 1.010 - - QHG48905
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm40441
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR43601
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5108
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.750

Return to query results.
Submit another query.