powered by:
Protein Alignment CG8517 and TXNDC8
DIOPT Version :9
Sequence 1: | NP_611446.3 |
Gene: | CG8517 / 37268 |
FlyBaseID: | FBgn0034472 |
Length: | 145 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016870068.1 |
Gene: | TXNDC8 / 255220 |
HGNCID: | 31454 |
Length: | 138 |
Species: | Homo sapiens |
Alignment Length: | 64 |
Identity: | 18/64 - (28%) |
Similarity: | 33/64 - (51%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 VVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVV 115
||.|.:..|.|||.:.| :.:.:|.:...|..|.||::...|||...::.::|:..:....:.|
Human 24 VVQFSSKRCGPCKRMFP-VFHAMSVKYQNVFFANVDVNNSPELAETCHIKTIPTFQMFKKSQKV 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8517 | NP_611446.3 |
Thioredoxin_like |
36..135 |
CDD:412351 |
18/64 (28%) |
TXNDC8 | XP_016870068.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.