DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and trx2

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_595954.2 Gene:trx2 / 2539898 PomBaseID:SPBC12D12.07c Length:133 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:43/135 - (31%)
Similarity:70/135 - (51%) Gaps:21/135 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSY--RRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPC 63
            |.|:  ||.|.:.|::..:.|              ||:..|:..| |::|:..||||:|.||.||
pombe    13 MRSFALRRSFTSSRILRKVNA--------------VESFGDYNTR-ISADKVTVVDFYADWCGPC 62

  Fly    64 KALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQT---SE 125
            |.|.|.||. :|||..:.....|:.|:..::|....|.::|::|:...|:.::|:||...   |.
pombe    63 KYLKPFLEK-LSEQNQKASFIAVNADKFSDIAQKNGVYALPTMVLFRKGQELDRIVGADVKTLSS 126

  Fly   126 YLRKW 130
            .|.|:
pombe   127 LLAKY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 34/98 (35%)
trx2NP_595954.2 TRX_family 39..122 CDD:239245 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.