DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and pdi-6

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_509190.1 Gene:pdi-6 / 180974 WormBaseID:WBGene00015168 Length:440 Species:Caenorhabditis elegans


Alignment Length:106 Identity:33/106 - (31%)
Similarity:57/106 - (53%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LMNLMKANRGMTS-----TGKQPIFDVETRKDFEQRVINSDRPVVVDFHASWCCPCKALAPRLEN 72
            |:.|:.|:..:||     :.|..:.:: |..:|:.:|||||...:|:|:|.||..||:|.|..:.
 Worm     3 LIKLLLASLAITSVCGMYSKKDDVVEL-TEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKK 66

  Fly    73 VVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGK 113
            ..|..:|..::..||:.:|..:...|||...|:|.:....|
 Worm    67 AASALKGVAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 27/78 (35%)
pdi-6NP_509190.1 PDI_a_P5 25..127 CDD:239299 27/84 (32%)
PDI_a_P5 165..269 CDD:239299
P5_C 278..407 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.