DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8517 and ZK973.11

DIOPT Version :9

Sequence 1:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_491361.1 Gene:ZK973.11 / 172039 WormBaseID:WBGene00022836 Length:447 Species:Caenorhabditis elegans


Alignment Length:67 Identity:17/67 - (25%)
Similarity:36/67 - (53%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VDFHASWCCPCKALAP---RLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKV 114
            |:|:|.||..||.|.|   ::.:.:|:....:|:.::|......:|...::...|:::...||.|
 Worm    48 VEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIRVGKLDCTRFPAVANKLSIQGYPTILFFRNGHV 112

  Fly   115 VN 116
            ::
 Worm   113 ID 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 17/67 (25%)
ZK973.11NP_491361.1 ER_PDI_fam 29..>348 CDD:273457 17/67 (25%)
PDI_a_TMX3 29..132 CDD:239298 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.