Sequence 1: | NP_611446.3 | Gene: | CG8517 / 37268 | FlyBaseID: | FBgn0034472 | Length: | 145 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491361.1 | Gene: | ZK973.11 / 172039 | WormBaseID: | WBGene00022836 | Length: | 447 | Species: | Caenorhabditis elegans |
Alignment Length: | 67 | Identity: | 17/67 - (25%) |
---|---|---|---|
Similarity: | 36/67 - (53%) | Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 VDFHASWCCPCKALAP---RLENVVSEQEGRVRLARVDIDEHGELALDYNVGSVPSLVVISNGKV 114
Fly 115 VN 116 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8517 | NP_611446.3 | Thioredoxin_like | 36..135 | CDD:412351 | 17/67 (25%) |
ZK973.11 | NP_491361.1 | ER_PDI_fam | 29..>348 | CDD:273457 | 17/67 (25%) |
PDI_a_TMX3 | 29..132 | CDD:239298 | 17/67 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |