DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56e and Obp99a

DIOPT Version :9

Sequence 1:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster


Alignment Length:137 Identity:35/137 - (25%)
Similarity:60/137 - (43%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFFVFAALAALSLASAVGLTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVKCF 65
            ||||.....|  :.||||..:..::......|.: |||:..:..:.....:...: .:|.|.:|:
  Fly     1 MKVFVAICVL--IGLASADYVVKNRHDMLAYRDE-CVKELAVPVDLVEKYQKWEY-PNDAKTQCY 61

  Fly    66 ANCFLEQTGL--VANGQIKPDVVLAKLGPIA--GEANVKEVQAKCD-STKGADKCDTSYLLYKCY 125
            ..|...:.||  |.:|....::....:|..|  .||....:.|..| :.:|::.|:.:|....|.
  Fly    62 IKCVFTKWGLFDVQSGFNVENIHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCL 126

  Fly   126 Y-ENHAQ 131
            . ||.||
  Fly   127 LKENLAQ 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 22/112 (20%)
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.