DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56e and Obp83cd

DIOPT Version :9

Sequence 1:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:141 Identity:36/141 - (25%)
Similarity:59/141 - (41%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFFVFAALAALSLASAVGLTDSQKAEAKQRAKACVKQ-EGITKEQAIAL-RSGNFADSDPKVK 63
            ||...:.|....|||...:.|.: .:.|...|   |::. .|:|.|.|..| |...::||..::.
  Fly     3 MKSGILIALCLCLSLNEGLALLE-HEGETINR---CIQNYGGLTAENAERLERFKEWSDSYEEIP 63

  Fly    64 CFANCFLEQ--------TGLVANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYL 120
            ||..|:|.:        ||...:|      ::...|....||..|:::...:|  |...|..:|.
  Fly    64 CFTRCYLSEMFDFYNNLTGFNKDG------IVGVFGRPVYEACRKKLELPFES--GESSCKHAYE 120

  Fly   121 LYKCY--YENH 129
            .:.|.  .|:|
  Fly   121 GFHCITNMESH 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 28/118 (24%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 26/109 (24%)
PhBP 149..242 CDD:214783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.