DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56e and Obp47a

DIOPT Version :9

Sequence 1:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:134 Identity:33/134 - (24%)
Similarity:63/134 - (47%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFFVFAALAALSLASA--------VGLT---DSQKAEAKQRAKACVKQEGITKEQAIALRSGNF 55
            :|..:...|...:|:.:        :|||   :|.|...::..:.|..|..|:..:...|:..:|
  Fly     3 RVLVLLLVLKMFALSESRFAKININLGLTVADESPKTITEEMIRLCGDQTDISLRELNKLQREDF 67

  Fly    56 ADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYL 120
            :|....|:||.:|..||.||:.:|......:...|..::......|.|  |.:.:|.:||:|:|.
  Fly    68 SDPSESVQCFTHCLYEQMGLMHDGVFVERDLFGLLSDVSNTDYWPERQ--CHAIRGNNKCETAYR 130

  Fly   121 LYKC 124
            :::|
  Fly   131 IHQC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 29/107 (27%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D128293at50557
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.