DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56e and LOC3291552

DIOPT Version :10

Sequence 1:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_061513859.1 Gene:LOC3291552 / 3291552 VectorBaseID:AGAMI1_008217 Length:133 Species:Anopheles gambiae


Alignment Length:81 Identity:22/81 - (27%)
Similarity:40/81 - (49%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 ALRSGNFADSDPKVKCFANCFLEQTGLV-ANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGA 112
            :||:|||:..:..|:||..||:::.|.: .|.....|.::........:...::|...|......
Mosquito    44 SLRAGNFSVRNSLVECFGECFVKRAGFMNDNFTFNRDTIMRFTNRFVSKEISEKVYNICTDNVTP 108

  Fly   113 DKCDTSYLLYKCYYEN 128
            ..|.|::.:|:|.|||
Mosquito   109 TYCVTAFDVYQCIYEN 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:460193 20/79 (25%)
LOC3291552XP_061513859.1 None

Return to query results.
Submit another query.