DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56e and Obp8a

DIOPT Version :9

Sequence 1:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster


Alignment Length:141 Identity:30/141 - (21%)
Similarity:55/141 - (39%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASAVGLTDSQKAEAKQRAK-ACVKQEGITKEQAIALRSGNFADSDPKVKCFANCF-------LEQ 72
            |..|.:..|.::.|..||: .|.::  :|..|.:.|....|.|: ..|:.:.:||       |::
  Fly    26 AIPVPMRSSPQSLALLRARDQCGRE--LTAAQRLQLDRMQFEDA-AHVRHYLHCFWSRLQLWLDE 87

  Fly    73 TGLVANGQIKPDVVLAKLGPIAGEANVKEVQA-----KCD---STKGADK---CDTSYLLYKC-- 124
            ||..|...::         ...||..:...||     .|:   |::|:..   .|..:..:.|  
  Fly    88 TGFQAQRIVQ---------SFGGERRLNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVL 143

  Fly   125 ------YYENH 129
                  :|:.|
  Fly   144 ATPVGEWYKRH 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 27/133 (20%)
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.