DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56e and Obp56c

DIOPT Version :9

Sequence 1:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster


Alignment Length:179 Identity:31/179 - (17%)
Similarity:65/179 - (36%) Gaps:58/179 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFFVFAALAALSLASAVGLT-----------DSQKAEAKQRAKACVKQEGITKEQA----IALRS 52
            :||:|......||:.::.::           .::...:::..:||:::..|:..|.    ::|.:
  Fly    25 MFFIFYISFTRSLSVSLNMSMTRTLVPDPPNGTENKLSQEMLRACMRRTEISMSQLKLFHMSLMN 89

  Fly    53 --------------------GNFADSD---------------PKVKCFANCFLEQTGLVANGQIK 82
                                .|..|.|               ..::||.:|..|...|.....:.
  Fly    90 SDYNNDNDIAPTPVQSIGDVNNLGDLDFNGNSQMPYLDLKHNEPLQCFVSCLYETLDLDRYNVLL 154

  Fly    83 PDVVLAKLGPIA--GEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENH 129
            .:....::..|.  .:|.:||    |...:|..:|:.:|.|:.||  ||
  Fly   155 EEAFKNQVQTIIQHEKAEIKE----CSDLQGKTRCEAAYKLHLCY--NH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 24/158 (15%)
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.