DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56d and Obp56e

DIOPT Version :9

Sequence 1:NP_001286619.1 Gene:Obp56d / 37266 FlyBaseID:FBgn0034470 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster


Alignment Length:130 Identity:83/130 - (63%)
Similarity:103/130 - (79%) Gaps:1/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVLSVILAIS-AAELQLSDEQKAVAHANGALCAQQEGITKDQAIALRNGNFDDSDPKVKCF 64
            ||...|.:.:.|:| |:.:.|:|.|||.|......|.:||||||:||||||:|||.|||||||||
  Fly     1 MKVFFVFAALAALSLASAVGLTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVKCF 65

  Fly    65 ANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKAVQAKCDATKGADKCDTAYQLFECYYKNRA 129
            ||||||:.|.:.||:::||||||||||:|||..||.||||||:|||||||||:|.|::|||:|.|
  Fly    66 ANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENHA 130

  Fly   130  129
              Fly   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56dNP_001286619.1 PBP_GOBP 19..127 CDD:279703 75/107 (70%)
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 75/106 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442152
Domainoid 1 1.000 80 1.000 Domainoid score I15408
eggNOG 1 0.900 - - E1_2CM03
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27204
OrthoDB 1 1.010 - - D128293at50557
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 1 1.000 - - mtm14825
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6479
109.860

Return to query results.
Submit another query.