DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56d and Obp56b

DIOPT Version :9

Sequence 1:NP_001286619.1 Gene:Obp56d / 37266 FlyBaseID:FBgn0034470 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster


Alignment Length:142 Identity:39/142 - (27%)
Similarity:62/142 - (43%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVLSVILAISAAELQLSDEQKAVAHANGALCAQ----QEGITKDQAIALRNGNFDDSDPK- 60
            ||.:.:|.|.|..:.:||        ||..:.|..|.    |:...|:..||..:.|...:|.: 
  Fly     1 MKLIYLLVVFLIFALSEL--------VAGQSAAELAAYKQIQQACIKELNIAASDANLLTTDKEV 57

  Fly    61 ------VKCFANCFLEKIGFL-INGEVQPDVVLAKLGPLAGE----DAVKAVQAKCDATKGADKC 114
                  |||:.:|..:|:|.| .:|:...|.:: ||..:...    |.:|::...|..||.|..|
  Fly    58 ANPSESVKCYHSCVYKKLGLLGDDGKPNTDKIV-KLAQIRFSSLPVDKLKSLLTSCGTTKSAATC 121

  Fly   115 DTAYQLFECYYK 126
            |..|...:|..|
  Fly   122 DFVYNYEKCVVK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56dNP_001286619.1 PBP_GOBP 19..127 CDD:279703 32/124 (26%)
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.