DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56d and Obp57e

DIOPT Version :9

Sequence 1:NP_001286619.1 Gene:Obp56d / 37266 FlyBaseID:FBgn0034470 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster


Alignment Length:93 Identity:24/93 - (25%)
Similarity:43/93 - (46%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CAQQEGITKDQA-IALRNGNFDDSDPKVKCFANCFLEKIGFL-INGEVQPDVVLAKLGPLAGE-D 96
            |..|..:::.:| ..:.|......|...|||..|.|..:|.: ..|.||.|..: |.|.:..: .
  Fly    28 CVSQNELSEYEAHQVMENWPVPPIDRAYKCFLTCVLLDLGLIDERGNVQIDKYM-KSGVVDWQWV 91

  Fly    97 AVKAVQAKCDATKGADKCDTAYQLFECY 124
            |::.|..:.:.:...|.|:.:|.:|.|:
  Fly    92 AIELVTCRIEFSDERDLCELSYGIFNCF 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56dNP_001286619.1 PBP_GOBP 19..127 CDD:279703 24/93 (26%)
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.