DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56b and Obp56g

DIOPT Version :9

Sequence 1:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_995903.1 Gene:Obp56g / 37270 FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster


Alignment Length:132 Identity:36/132 - (27%)
Similarity:60/132 - (45%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLIYLLVVFLIFALSELVAGQSAAELAAYKQIQQACIKELNIAASD-ANLLTTDKEVANPSESV 64
            |:..:.|.: |:..||.::|.|:..:.:..|::...|:||..:...| |:|.:...:..:..::|
  Fly     1 MRATFALTL-LLGCLSGILAQQANIDSSVSKELVTDCLKENGVTPQDLADLQSGKVKAEDAKDNV 64

  Fly    65 KCYHSCVYKKLGLLGDDGKPNTDKIVK-LAQIRFSSLPVDKLKSLLTSCGTTKSAATCDFVYNYE 128
            ||...|:..|.|.:...||..||||.. .|...|.    |.::..|..|...|.|..||..:...
  Fly    65 KCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFK----DVIEKDLDRCSAVKGANACDTAFKIL 125

  Fly   129 KC 130
            .|
  Fly   126 SC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 28/98 (29%)
Obp56gNP_995903.1 PBP_GOBP 30..131 CDD:279703 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D128293at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.