DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56b and Obp44a

DIOPT Version :9

Sequence 1:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster


Alignment Length:130 Identity:30/130 - (23%)
Similarity:46/130 - (35%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVFLIFALSELVAGQSAAELAAYKQIQQA---CIKELNIAASDANLLTTDKEVANPSESV-KCYH 68
            |..|:.||..| |..|..:|...:.:|.|   |.....:..:   |:...|....|.:.: :.|.
  Fly     5 VAILLCALLGL-ASASDYKLRTAEDLQSARKECAASSKVTEA---LIAKYKTFDYPDDDITRNYI 65

  Fly    69 SCVYKKLGLLGDDGKPNTDKIVKLAQIRFSSLPVDKLKSLLTSCGTTKSAATCDFVYNYEKCVVK 133
            .|::.|..|. |:.|               ...|:.|.:.|......|:|...|.    |||..|
  Fly    66 QCIFVKFDLF-DEAK---------------GFKVENLVAQLGQGKEDKAALKADI----EKCADK 110

  Fly   134  133
              Fly   111  110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 21/103 (20%)
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.