DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56b and Obp19c

DIOPT Version :9

Sequence 1:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster


Alignment Length:154 Identity:35/154 - (22%)
Similarity:63/154 - (40%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVVFLIFALSELVAGQSAA-ELAA-----------------YKQIQQ-------ACIKELNIAA 45
            :.:|..:...:..|.||:.| :||.                 ..|:|:       .||::|.:..
  Fly    13 MTIVVAVLLQTHCVRGQTQAFDLAKLLPKTGTEPIWAVIDRNLPQVQELVTAARMECIQKLQLPR 77

  Fly    46 SDANLLTTDKEVANPSESVKCYHSCVYKKLGLLGDDGKPNTDKIVKLAQI--RFSSLPVDKLKSL 108
            ....|    .:|.||||..||...||.||:.|:..|.|.|..::.||..:  :.:.:.:....|:
  Fly    78 DQRPL----GKVTNPSEKEKCLVECVLKKIKLMDADNKLNVGQVEKLTSLVTQDNKMAIAVSSSM 138

  Fly   109 LTSCGT-TKSAATCDFVYNYEKCV 131
            ..:|.. ..|...|:..:.:.:|:
  Fly   139 AQACSRGISSKNPCEVAHLFNQCI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 26/107 (24%)
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.