DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56b and Obp19b

DIOPT Version :9

Sequence 1:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_608391.2 Gene:Obp19b / 33038 FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster


Alignment Length:149 Identity:29/149 - (19%)
Similarity:60/149 - (40%) Gaps:26/149 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLIYLLVVFLIFALSELVAGQSAAE-----------LAAYKQIQQACIKELNIAASDANL--LT 52
            :|:..||   |..|.:.::.|.:.|:           :...:....||..:    .|..|:  :.
  Fly    11 LKMTNLL---LAVACAAVLMGSATADEEEGSMTVDEVVELIEPFGDACTPK----PSRENIVEMV 68

  Fly    53 TDKEVANPSESVKCYHSCVYKKLGLLGDDG-KPNTDKIVKLAQIRFSSLPVDKLKSLLTSCGTTK 116
            .:||.|  ....||:..|:.::..|:.:|. :.|.||.|.:..:.|.... |..:.::.:|....
  Fly    69 LNKEDA--KHETKCFRHCMLEQFELMPEDQLQYNEDKTVDMINMMFPDRE-DDGRRIVKTCNEEL 130

  Fly   117 SAA--TCDFVYNYEKCVVK 133
            .|.  .|:..:....|:::
  Fly   131 KAEQDKCEAAHGIAMCMLR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 22/104 (21%)
Obp19bNP_608391.2 PBP_GOBP 38..150 CDD:279703 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.