DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56b and Obp56i

DIOPT Version :9

Sequence 1:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster


Alignment Length:105 Identity:25/105 - (23%)
Similarity:48/105 - (45%) Gaps:17/105 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IQQACIKELNIAASD-ANLLTTDKEVANPSESVKCYHSCVYKKLGLLGDDGKPNTDKIVKLA--Q 94
            |:..|:....|.|.| ||...||    :|..||||:..|..:.:|::.|      ::|:..|  :
  Fly    26 IKDQCMAAAGITAQDVANRHETD----DPGHSVKCFFRCFLENIGIIAD------NQIIPGAFDR 80

  Fly    95 IRFSSLPVDKLKSLLTSCGTTKSAA----TCDFVYNYEKC 130
            :....:..:.::.:..:|...||..    :|:|.:...:|
  Fly    81 VLGHIVTAEAVERMEATCNMIKSETSHDESCEFAWQISEC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 24/103 (23%)
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:279703 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.