DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp99b

DIOPT Version :9

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:78 Identity:21/78 - (26%)
Similarity:35/78 - (44%) Gaps:15/78 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFVTLAVGSSLNLSDE-----------QKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTENI 65
            :.:.|.:|.:..|:|.           .:||. .:|.||.|:|..:||...|.  |.:..|.:.:
  Fly     3 VLIVLLLGLAFVLADHHHHHHDYVVKTHEDLT-NYRTQCVEKVHASEELVEKY--KKWQYPDDAV 64

  Fly    66 -KCFANCFFEKVG 77
             .|:..|.|:|.|
  Fly    65 THCYLECIFQKFG 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 19/66 (29%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.