DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp99b

DIOPT Version :10

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_651713.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:78 Identity:21/78 - (26%)
Similarity:35/78 - (44%) Gaps:15/78 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFVTLAVGSSLNLSDE-----------QKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTENI 65
            :.:.|.:|.:..|:|.           .:||. .:|.||.|:|..:||...|.  |.:..|.:.:
  Fly     3 VLIVLLLGLAFVLADHHHHHHDYVVKTHEDLT-NYRTQCVEKVHASEELVEKY--KKWQYPDDAV 64

  Fly    66 -KCFANCFFEKVG 77
             .|:..|.|:|.|
  Fly    65 THCYLECIFQKFG 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 19/66 (29%)
Obp99bNP_651713.1 PBP_GOBP 24..137 CDD:460193 17/57 (30%)

Return to query results.
Submit another query.