DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp99c

DIOPT Version :10

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster


Alignment Length:155 Identity:32/155 - (20%)
Similarity:62/155 - (40%) Gaps:25/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSYFVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTENI 65
            |..|.::||:...|..|...:....:|.:.:    |..|.:|..|:.::.:::....|.|..: :
  Fly     1 MLKYLIVALALCAVAHADDWTPKTGEEIRKI----RVDCLKENPLSNDQISQLKNLIFPNEPD-V 60

  Fly    66 KCFANCFFEKVGTLKDGELQESVVLEKLGAL----IGEEKTKAALEKCRTIKGE----------- 115
            :.:..|...|:|...|   |:....::|...    :.||:.....:.|.....:           
  Fly    61 RQYLTCSAIKLGIFCD---QQGYHADRLAKQFKMDLSEEEALQIAQSCVDDNAQKNPTDVWAFRG 122

  Fly   116 NKCDTASKLYDCFESF--KPAPEAK 138
            ::|..|||:.|...:|  ..|.|||
  Fly   123 HQCMMASKIGDKVRAFVKAKAEEAK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 21/118 (18%)
Obp99cNP_651711.1 PBP_GOBP 19..128 CDD:460193 17/116 (15%)

Return to query results.
Submit another query.