DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp69a

DIOPT Version :9

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster


Alignment Length:131 Identity:35/131 - (26%)
Similarity:59/131 - (45%) Gaps:14/131 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNN---PTE-NI 65
            |.:||..|:..:.....:.::.......::.|.:|..:...:.:    |..|...|   ||: .|
  Fly     8 FFLALLILYDLIPSNQGVEINPTIIKQVRKLRMRCLNQTGASVD----VIDKSVKNRILPTDPEI 68

  Fly    66 KCFANCFFEKVGTLKDGELQESVVLEKLGALIGEE--KT-KAALEKCRTIKGENKCDTASKLYDC 127
            |||..|.|:..|.:   :.|..:.||.|..::.||  || ...:..|.|.||::.||||.:...|
  Fly    69 KCFLYCMFDMFGLI---DSQNIMHLEALLEVLPEEIHKTINGLVSSCGTQKGKDGCDTAYETVKC 130

  Fly   128 F 128
            :
  Fly   131 Y 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 30/110 (27%)
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.