DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp56h

DIOPT Version :9

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001188979.1 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster


Alignment Length:137 Identity:41/137 - (29%)
Similarity:65/137 - (47%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDF-NNPTENIKCF 68
            |.|||:|.         |::.....|. :|..:||.|..::||.:..:..|... ::..||:||:
  Fly     6 FCIALAAF---------LSMGQCNPDF-RQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCY 60

  Fly    69 ANCFFEKVGTLKDGELQESVVLEKLGALIGEEKTK-----AALEKCRTIKGENKCDTASKLYDCF 128
            ..|..||.|.|.:|:.....:|:.| ..:.:.|.|     :.:..|:.|||.|.||||.|:..|.
  Fly    61 TKCLMEKQGHLTNGQFNAQAMLDTL-KNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCL 124

  Fly   129 ESFKPAP 135
            :..|..|
  Fly   125 KEHKAIP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 32/109 (29%)
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FB6J
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.