DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp56e

DIOPT Version :9

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster


Alignment Length:129 Identity:51/129 - (39%)
Similarity:77/129 - (59%) Gaps:5/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSYFVI-ALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTEN 64
            |..:||. ||:||.:..|||    |:|.||..|||..:.|.::..:|:|:...:.:.:|.:....
  Fly     1 MKVFFVFAALAALSLASAVG----LTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPK 61

  Fly    65 IKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEEKTKAALEKCRTIKGENKCDTASKLYDCF 128
            :|||||||.|:.|.:.:|:::..|||.|||.:.||...|....||.:.||.:||||:..||.|:
  Fly    62 VKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 40/103 (39%)
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 41/105 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I15408
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27204
OrthoDB 1 1.010 - - D128293at50557
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 1 1.000 - - mtm14825
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6479
88.030

Return to query results.
Submit another query.