DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp47a

DIOPT Version :10

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:142 Identity:38/142 - (26%)
Similarity:72/142 - (50%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSYFVIAL--------SALFVTLAVGSSLNLSDEQ-KDLAKQHREQCAEEVKLTEEEKAKVNAK 56
            ||...|:.|        .:.|..:.:...|.::||. |.:.::....|.::..::..|..|:..:
  Fly     1 MNRVLVLLLVLKMFALSESRFAKININLGLTVADESPKTITEEMIRLCGDQTDISLRELNKLQRE 65

  Fly    57 DFNNPTENIKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEEKTKAALEK-CRTIKGENKCDT 120
            ||::|:|:::||.:|.:|::|.:.||...|.   :..|.|.....|....|: |..|:|.|||:|
  Fly    66 DFSDPSESVQCFTHCLYEQMGLMHDGVFVER---DLFGLLSDVSNTDYWPERQCHAIRGNNKCET 127

  Fly   121 ASKLYDCFESFK 132
            |.:::.|.:..|
  Fly   128 AYRIHQCQQQLK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 30/105 (29%)
Obp47aNP_610632.1 PhBP 44..132 CDD:214783 27/90 (30%)

Return to query results.
Submit another query.