DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp28a

DIOPT Version :10

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster


Alignment Length:139 Identity:39/139 - (28%)
Similarity:58/139 - (41%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFVTLAVGSSL-NLSDEQKDLAK--QHREQCAEEVKLTEEEKAKVNAKDFNNPTENI--KCFANC 71
            |...:.:|::| ...||::.|||  :..|.|..||..|:.:..::..|   .|....  ||...|
  Fly     8 LVAIVLLGAALVRAFDEKEALAKLMESAESCMPEVGATDADLQEMVKK---QPASTYAGKCLRAC 69

  Fly    72 FFEKVGTL-KDGELQESVVLEKLGALIGEE--KTKAALE---KCRTIK-GENKCDTASKLYDCFE 129
            ..:.:|.| .:|:|......||.....|.:  |.|.|||   .|..|. .::.|:.|.....||.
  Fly    70 VMKNIGILDANGKLDTEAGHEKAKQYTGNDPAKLKIALEIGDTCAAITVPDDHCEAAEAYGTCFR 134

  Fly   130 SFKPAPEAK 138
            .     |||
  Fly   135 G-----EAK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 31/114 (27%)
Obp28aNP_523505.1 PBP_GOBP 24..134 CDD:460193 31/112 (28%)

Return to query results.
Submit another query.